Online Inquiry
FMO3 Antibody
SPA-04056
| Size | Price |
| 0.1 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | FMO3 |
| Gene Abbr. | FMO3 |
| Gene ID | 2328 |
| Full Name | flavin containing dimethylaniline monoxygenase 3 |
| Alias | FMOII, TMAU, dJ127D3.1 |
| Introduction | The mammalian flavin-containing monooxygenases (FMO; EC 1.14.13.8) represent a multigene family whose gene products are localized in the endoplasmic reticulum of many tissues. These enzymes catalyze the NADPH-dependent oxidative metabolism of many drugs, pesticides, and other foreign compounds. Their substrates are soft nucleophiles with an electron-rich center, typically a nitrogen, sulfur or phosphorus-containing functional group, as the site for oxidative attack by the enzyme (Ziegler, 1990 [PubMed 2203193]; Hines et al., 1994 [PubMed 8128486]).[supplied by OMIM] |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptide towards Fmo3. Peptide sequence KPNVKEFTETSAVFEDGTMFEAIDCVIFATGYGYAYPFLDDSIIKSRNNE. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1:1000) |
| Reactivity | Mouse, Human, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.