Online Inquiry
FMO3 Antibody
SPA-04053
| Size | Price |
| 0.1 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | FMO3 |
| Gene Abbr. | FMO3 |
| Gene ID | 2328 |
| Full Name | flavin containing dimethylaniline monoxygenase 3 |
| Alias | FMOII, TMAU, dJ127D3.1 |
| Introduction | The mammalian flavin-containing monooxygenases (FMO; EC 1.14.13.8) represent a multigene family whose gene products are localized in the endoplasmic reticulum of many tissues. These enzymes catalyze the NADPH-dependent oxidative metabolism of many drugs, pesticides, and other foreign compounds. Their substrates are soft nucleophiles with an electron-rich center, typically a nitrogen, sulfur or phosphorus-containing functional group, as the site for oxidative attack by the enzyme (Ziegler, 1990 [PubMed 2203193]; Hines et al., 1994 [PubMed 8128486]).[supplied by OMIM] |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: IYKSVFSNSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPK. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:200-1:500) |
| Reactivity | Human |
| Specificity | Specificity of human FMO3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.