Online Inquiry
FLASH Antibody
SPA-04007
Size | Price |
0.1 mg | Online Inquiry |
0.025 mg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | FLASH |
Gene Abbr. | CASP8AP2 |
Gene ID | 9994 |
Full Name | caspase 8 associated protein 2 |
Alias | CED-4, FLASH, RIP25 |
Introduction | A novel mammalian CED-4 homologous was recently identified and cloned in mouse and human and designated FLASH (for FLICE-associated huge protein). FLASH is involved in Fas induced apoptosis. It is recruited to Fas after the receptor cross-linking. Overexpression of wild type of FLASH facilitates and its dominant negative form inhibits Fas induced apoptosis. FLASH interacts with the DEDs of caspase-8 and FADD through the DED-like domain of FLASH and mediates activation of caspase-8. There are parallels between FLASH and Apaf-1/CED-4 although there are arguments against their structural similarity. FLASH is widely expressed. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to the following amino acid sequence: EKAQVANRPLKCIVEETYIDLTTESPSSCEVKKDELKSEPGSNCDNSELPGTLHNSHKKRRNISDLNHPHKKQRKETDLTNKEKTKKPTQDSCENTEAHQ. |
Usage | |
---|---|
Application | IF |
Dilutions | Immunofluorescence (0.25-2 µg/mL) |
Reactivity | Human |
Specificity | Specificity of human FLASH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.