Online Inquiry
Fibronectin Antibody
SPA-03974
Size | Price |
0.025 mL | Online Inquiry |
0.1 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Fibronectin |
Gene Abbr. | FN1 |
Gene ID | 2335 |
Full Name | fibronectin 1 |
Alias | CIG, ED-B, FINC, FN, FNZ |
Introduction | Fibronectin is an adhesive glycoprotein with a molecular mass of 440 kDa. It is believed to be important for the formation of a provisional matrix that promotes cell adhesion and migration during wound healing. Its age-dependent increase in plasma and tissues may be accompanied in pathological states, especially in tumor growth, by its proteolytic breakdown by a number of neutral proteases. It has also shown that several of its proteolytic breakdown products exhibit unexpected and mostly harmful biological activities. |
Product Details | |
---|---|
Host | Mouse |
Clonality | Monoclonal |
Clone No. | CL3730 |
Isotype | IgG1 |
Immunogen | Recombinant Protein corresponding to amino acids: HEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIG. |
Usage | |
---|---|
Application | WB, IHC |
Dilutions | Western Blot (1 µg/mL); Immunohistochemistry (1:1000-1:2500) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human Fibronectin/Anastellin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.