Online Inquiry
FFAR1/GPR40 Antibody
SPA-03857
| Size | Price |
| 0.05 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | FFAR1/GPR40 |
| Gene Abbr. | FFAR1 |
| Gene ID | 2864 |
| Full Name | free fatty acid receptor 1 |
| Alias | FFA1R, GPCR40, GPR40 |
| Introduction | GPR40 is classified as a Carboxylic Acid GPCR that may be associated with glucose and insulin secretion to regulate pancreatic islet function. Additional roles in neurological functions have also been speculated. GPR40 expression has been reported primarily in brain and pancreas. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Immunogen | Synthetic peptide directed towards the N-terminal region of human FFAR1/GPR40. Peptide sequence: KVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLV The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Reactivity | Human, Porcine, Bovine, Canine |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS, 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.