EXD2 Antibody - CD BioSciences

service-banner

EXD2 Antibody

EXD2 Antibody

SPA-03726

Size Price
0.1 mL Online Inquiry
25 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name EXD2
Gene Abbr. EXD2
Gene ID 55218
Full Name exonuclease 3'-5' domain containing 2
Alias C14orf114, EXDL2
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the middle region of human EXD2. Peptide sequence: EEVNGEATESQQKPRNKKSKMDGMVPGNHQGRDPRKHKRKPLGVGYSARK The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Reactivity Human
Storage & Handling
Storage Buffer PBS, 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.