Online Inquiry
ERp57 Antibody
SPA-03688
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | ERp57 |
| Gene Abbr. | PDIA3 |
| Gene ID | 2923 |
| Full Name | protein disulfide isomerase family A member 3 |
| Alias | ER60, ERp57, ERp60, ERp61, GRP57 |
| Introduction | Secretory proteins translocate into the endoplasmic reticulum (ER) after their synthesis where they are post-translationally modified and properly folded. To reach their native conformation, many secretory proteins require the formation of intra- or inter-molecular disulfide bonds. This process is called oxidative protein folding. Disulfide isomerase (PDI) has two thioredoxin homology domains and catalyzes the formation and isomerization of these disulfide bonds. Other ER resident proteins that possess the thioredoxin homology domains, including endoplasmic reticulum stress protein 57 (ERp57), constitute the PDI family. ERp57 interacts with calnexin and calreticulin and is suggested to play a role in the isomerization of disulfide bonds on certain glycoproteins. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK. |
| Usage | |
|---|---|
| Application | WB, IF, IHC |
| Dilutions | Western Blot (1:100-1:500); Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:10-1:500) |
| MW(KDa) | 57 |
| Reactivity | Human, Mouse, Rat |
| Validation | Knockdown Validated. |
| Specificity | Specificity of human ERp57/PDIA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.