ERp57 Antibody - CD BioSciences

service-banner

ERp57 Antibody

ERp57 Antibody

SPA-03688

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name ERp57
Gene Abbr. PDIA3
Gene ID 2923
Full Name protein disulfide isomerase family A member 3
Alias ER60, ERp57, ERp60, ERp61, GRP57
Introduction Secretory proteins translocate into the endoplasmic reticulum (ER) after their synthesis where they are post-translationally modified and properly folded. To reach their native conformation, many secretory proteins require the formation of intra- or inter-molecular disulfide bonds. This process is called oxidative protein folding. Disulfide isomerase (PDI) has two thioredoxin homology domains and catalyzes the formation and isomerization of these disulfide bonds. Other ER resident proteins that possess the thioredoxin homology domains, including endoplasmic reticulum stress protein 57 (ERp57), constitute the PDI family. ERp57 interacts with calnexin and calreticulin and is suggested to play a role in the isomerization of disulfide bonds on certain glycoproteins.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK.
Usage
Application WB, IF, IHC
Dilutions Western Blot (1:100-1:500); Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:10-1:500)
MW(KDa) 57
Reactivity Human, Mouse, Rat
Validation Knockdown Validated.
Specificity Specificity of human ERp57/PDIA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.