Online Inquiry
Ephrin-B3 Antibody
SPA-03638
Size | Price |
0.1 mL | Online Inquiry |
25 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Ephrin |
Gene Abbr. | EFNB3 |
Gene ID | 1949 |
Full Name | ephrin B3 |
Alias | EFL6, EPLG8, LERK8 |
Introduction | Ephrin-B3, also known as NLERK-2, Elk-L3, EFL-6, ELF-3 and LERK-8, is a member of the Ephrin ligand family which binds members of the Eph receptor family. All ligands share a conserved extracellular sequence, which most likely corresponds to the receptor binding domain. This conserved sequence consists of approximately 125 amino acids (aa) and includes four invariant cysteines. The B-class ligands are transmembrane proteins which can be tyrosine phosphorylated upon receptor ligation. The cytoplasmic domains are approximately 80 aa long and are highly conserved, especially the last 33 aa. Several signaling molecules have been shown to interact with the cytoplasmic region, although specific signaling roles have yet to be elucidated. Ephrin-B3 has been shown to bind EphA4, EphB1, EphB2, and EphB3. The extracellular domains of murine and human Ephrin-B3 share 98% aa identity. Only membrane-bound or Fc-clustered ligands are capable of activating the receptor in vitro. While soluble monomeric ligands bind the receptor, they do not induce receptor autophosphorylation and activation. In vivo, the ligands and receptors display reciprocal expression. It has been found that nearly all the receptors and ligands are expressed in developing and adult neural tissue. The Ephrin/Eph families also appear to play a role in angiogenesis. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: HSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSNATS. |
Usage | |
---|---|
Application | IF, IHC |
Dilutions | Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:20-1:50) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human Ephrin-B3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.