Online Inquiry
EphB1 Antibody
SPA-03540
Size | Price |
25 µg | Online Inquiry |
100 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | EphB1 |
Gene Abbr. | EPHB1 |
Gene ID | 2047 |
Full Name | EPH receptor B1 |
Alias | ELK, EPHT2, Hek6, NET |
Introduction | EphB6 is a kinase-defective receptor and member of the ephrin-B family of transmembrane proteins. Although lacking kinase activity, EphB6 can regulate cellular functions through its interaction with adaptor proteins and other Eph family members. In hematopoietic cells, EphB6 is specifically expressed in the T cell population and functions as an important regulator of T cell receptor (TCR) mediated signaling. Upon binding with its ephrin-B1 or ephrin-B2 ligand, EphB6 modulates TCR activity through inhibition of JNK signaling, reduction of CD25 expression, and decreased IL-2 secretion. Reduced levels of cell proliferation and cytokine secretion are seen in EphB6 knock-out mice relative to wild type. In conjunction with EphB3 receptor activation, EphB6 suppresses Fas receptor induced apoptosis by triggering the Akt activation pathway. Research indicates that decreased EphB6 expression is associated with a higher degree of metastasis in various cancers, including breast cancer lung cancer and neuroblastoma. EphB6 is thought to reduce cancer invasiveness through its effect on cell adhesion and migration. Following EphrinB1 ligand binding, EphB6 is phosphorylated by kinases such as Src and another active EphB kinase. Phosphorylated EphB6 forms a stable complex with Cbl and initiates Cbl inhibition of cell adhesion. EphB6 regulates signal transduction through direct interaction with other active Eph receptor kinases, sequestering these EphB6-bound receptors and inhibiting typical signal transduction function. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to the following amino acid sequence: TCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNE. |
Usage | |
---|---|
Application | IF, IHC |
Dilutions | Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:2500-1:5000) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human EphB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.