Online Inquiry
EpCAM/TROP1 Antibody
SPA-03442
Size | Price |
0.025 mL | Online Inquiry |
0.1 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | EpCAM/TROP1 |
Gene Abbr. | EPCAM |
Gene ID | 4072 |
Full Name | epithelial cell adhesion molecule |
Alias | DIAR5, EGP-2, EGP314, EGP40, ESA |
Introduction | The type I transmembrane glycoprotein EpCAM consists of two epidermal growth factor-like extracellular domains, a cysteine-poor region, a transmembrane domain, and a short cytoplasmic tail. EpCAM is encoded by the GA733-2 gene located on the long arm of chromosome 4. EpCAM has been described by various names, including those associated with monoclonal antibodies specific for the cell surface antigen (MH99, AUA1, MOC31, 323/A3, kS1/4, GA733, and HEA125) and cDNA clones used to define the antigen kS 1/4, EGP, EGP40, and GA733-2. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: LFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYY. |
Usage | |
---|---|
Application | WB, IHC |
Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:200-1:500) |
Reactivity | Human |
Specificity | Specificity of human EpCAM/TROP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.