EpCAM/TROP1 Antibody - CD BioSciences

service-banner

EpCAM/TROP1 Antibody

EpCAM/TROP1 Antibody

SPA-03442

Size Price
0.025 mL Online Inquiry
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name EpCAM/TROP1
Gene Abbr. EPCAM
Gene ID 4072
Full Name epithelial cell adhesion molecule
Alias DIAR5, EGP-2, EGP314, EGP40, ESA
Introduction The type I transmembrane glycoprotein EpCAM consists of two epidermal growth factor-like extracellular domains, a cysteine-poor region, a transmembrane domain, and a short cytoplasmic tail. EpCAM is encoded by the GA733-2 gene located on the long arm of chromosome 4. EpCAM has been described by various names, including those associated with monoclonal antibodies specific for the cell surface antigen (MH99, AUA1, MOC31, 323/A3, kS1/4, GA733, and HEA125) and cDNA clones used to define the antigen kS 1/4, EGP, EGP40, and GA733-2.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: LFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYY.
Usage
Application WB, IHC
Dilutions Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:200-1:500)
Reactivity Human
Specificity Specificity of human EpCAM/TROP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.