Online Inquiry
EMR4P Antibody
SPA-03396
Size | Price |
0.1 mg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | EMR4P |
Gene Abbr. | ADGRE4P |
Gene ID | 326342 |
Full Name | adhesion G protein-coupled receptor E4, pseudogene |
Alias | EMR4, EMR4P, FIRE, GPR127, PGR16 |
Introduction | EMR4P is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. Thus, the protein would lack a transmembrane domain and the protein encoded by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, the possibility also exists that this gene may represent a transcribed pseudogene. |
Product Details | |
---|---|
Host | Mouse |
Clonality | Monoclonal |
Clone No. | 2H8 |
Isotype | IgG2A Kappa |
Immunogen | EMR4 (XP_377506, 21 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG. |
Usage | |
---|---|
Application | WB, ELISA, IF |
Dilutions | Western Blot (1:500) |
Reactivity | Human |
Specificity | EMR4 - egf-like module containing, mucin-like, hormone receptor-like 4. |
Storage & Handling | |
---|---|
Storage Buffer | In 1X PBS, pH 7.4. |
Preservative | No Preservative |
Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.