Online Inquiry
EMR3 Antibody
SPA-03393
| Size | Price |
| 0.05 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | EMR3 |
| Gene Abbr. | ADGRE3 |
| Gene ID | 84658 |
| Full Name | adhesion G protein-coupled receptor E3 |
| Alias | EMR3 |
| Introduction | EMR3 is an Orphan-B GPCR with an unknown ligand. Two variants are produced by alternative splicing. One form encodes a 652-amino acid GPCR consisting of two EGF-like domains and a mucin stalk, while the other is a truncated soluble form containing only two EGF-like domains. EMR3 and EMR2 share a high degree of sequence identity in the transmembrane domains. EMR3 has been reported to be expressed in neutrophils, monocytes, and macrophages. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: NASCVNNTHCTCNHGYTSGSGQKLFTFPLETCNDINECTPPYSVYCGFNAVCYNVEGSFYCQCVPGYRLHSGNEQFSNSNENTCQDTTSSKTTEGRKELQKIVDKFESLLTNQTLWRTEGRQEISSTATTILRDVESKVL. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:50-1:200) |
| Reactivity | Human |
| Specificity | Specificity of human EMR3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.