eIF2β Antibody - CD BioSciences

service-banner

eIF2β Antibody

eIF2β Antibody

SPA-03343

Size Price
0.1 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name eIF2β
Gene Abbr. EIF2S2
Gene ID 8894
Full Name eukaryotic translation initiation factor 2 subunit beta
Alias EIF2, EIF2B, EIF2beta, PPP1R67, eIF-2-beta
Introduction Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. [provided by RefSeq]
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: DEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKK.
Usage
Application IF, IHC
Dilutions Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:50-1:200)
Reactivity Human, Mouse, Rat
Specificity Specificity of human EIF2 beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.