EFCAB14 Antibody - CD BioSciences

service-banner

EFCAB14 Antibody

EFCAB14 Antibody

SPA-03239

Size Price
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name EFCAB14
Gene Abbr. EFCAB14
Gene ID 9813
Full Name EF-hand calcium binding domain 14
Alias KIAA0494
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptides corresponding to KIAA0494(KIAA0494) The peptide sequence was selected from the N terminal of KIAA0494. Peptide sequence DLDALKEKFRTMESNQKSSFQEIPKLNEELLSKQKQLEKIESGEMGLNKV. The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB, IHC
Dilutions Western Blot (1:100-1:2000); Immunohistochemistry (1:10-1:500)
Reactivity Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.