Online Inquiry
eEF1A1 Antibody
SPA-03231
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | eEF1A |
| Gene Abbr. | EEF1A1 |
| Gene ID | 1915 |
| Full Name | eukaryotic translation elongation factor 1 alpha 1 |
| Alias | CCS-3, CCS3, EE1A1, EEF-1, EEF1A |
| Introduction | Translation is the process where amino acid residues are assembled into polypeptides on ribosomes. This process is generally divided into three stages: initiation, elongation and termination. During elongation, mRNA and tRNA pair at the two active sites (A and P sites) on the ribosome. A number of eukaryotic elongation factors (eEFs) are involved in this process in mammalian cells. eEF1A, also called elongation factor Tu (EF-Tu), binds GTP and interacts with amino acyl-tRNAs to promote recruitment of amino acyl-tRNAs to the A-site of the ribosome. After GTP hydrolysis, GDP-eEF1A leaves the ribosome and is later converted back to the GTP-eEF1A by eEF1B. Studies have shown that eEF1A is phosphorylated under certain conditions, indicating that its activity is regulated at the post-translational level. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to EEF1A1(eukaryotic translation elongation factor 1 alpha 1) The peptide sequence was selected from the C terminal of EEF1A1 (NP_001393). Peptide sequence IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (2.5 µg/mL) |
| MW(KDa) | 50 |
| Reactivity | Human, Mouse, Rat, Bovine, Canine, Equine, Goat, Guinea Pig, Rabbit, Sheep |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.