DUSP8 Antibody - CD BioSciences

service-banner

DUSP8 Antibody

DUSP8 Antibody

SPA-03159

Size Price
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name DUSP8
Gene Abbr. DUSP8
Gene ID 1850
Full Name dual specificity phosphatase 8
Alias C11orf81, HB5, HVH-5, HVH8
Introduction USP8 is a ubiquitin specific protease that plays an important regulatory role at the level of protein turnover by preventing degradation. USP8 is involved in cell proliferation, and probably regulates the stability of STAM2 and RASGRF1. USP8 may regulate T-cell anergy mediated by RNF128 via the formation of a complex containing RNF128 and STAM2. As revealed by structur/function studies, USP8 forms a ternary complex with RNF128 and OTUB1, and interacts with the SH3 domain of STAM2 and RASGRF1. Expression of USP8 is induced Upon growth stimulation in starved human fibroblasts, and expression decreases in response to growth arrest induced by cell-cell contact.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptides corresponding to DUSP8(dual specificity phosphatase 8) The peptide sequence was selected from the middle region of DUSP8. Peptide sequence PAPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRP. The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Dilutions Western Blot (0.2-1 µg/mL)
Reactivity Human, Mouse, Rat, Bovine, Canine, Guinea Pig
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.