Online Inquiry
DUSP7 Antibody
SPA-03152
| Size | Price |
| 100 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | DUSP7 |
| Gene Abbr. | DUSP7 |
| Gene ID | 1849 |
| Full Name | dual specificity phosphatase 7 |
| Alias | MKPX, PYST2 |
| Introduction | Dusp7 is a protein phosphatase; suppresses MAP kinase activation state. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | The immunogen for this antibody is Dusp7 - middle region. Peptide sequence GLGGLRISSDCSDGESDRELPSSATESDGSPVPSSQPAFPVQILPYLYLG. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1:1000) |
| Reactivity | Rat, Human, Mouse, Bovine, Canine, Equine, Guinea Pig, Rabbit |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.