Online Inquiry
DUSP4/MKP2 Antibody
SPA-03136
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | DUSP4/MKP2 |
| Gene Abbr. | DUSP4 |
| Gene ID | 1846 |
| Full Name | dual specificity phosphatase 4 |
| Alias | HVH2, MKP-2, MKP2, TYP |
| Introduction | MAP kinases are inactivated by dual-specificity protein phosphatases (DUSPs) that differ in their substrate specificity, tissue distribution, inducibility by extracellular stimuli, and cellular localization. DUSPs, also known as MAPK phosphatases (MKP), specifically dephosphorylate both threonine and tyrosine residues in MAPK P-loops and have been shown to play important roles in regulating the function of the MAPK family. At least 13 members of the family (DUSP1-10, DUSP14, DUSP16, and DUSP22) display unique substrate specificities for various MAP kinases. MAPK phosphatases typically contain an amino-terminal rhodanese-fold responsible for DUSP docking to MAPK family members and a carboxy-terminal catalytic domain. These phosphatases can play important roles in development, immune system function, stress responses, and metabolic homeostasis. In addition, research studies have implicated DUSPs in the development of cancer and the response of cancer cells to chemotherapy.DUSP4 (MKP2, hVH2) is a nuclear dual-specificity phosphatase that is a negative regulator of Erk1/2 signaling by dephosphorylating and inactivating Erk1/2 in response to growth factors. Treatment with mitogen or expression of activating mutations of Ras (G12V) or Raf (V600E) promote increased expression of DUSP4 and a coincident decrease in phospho-Erk in the nucleus. In contrast, numerous studies have detected decreased expression of DUSP4 in a variety of tumor types, resulting in increased signaling via the Ras/Erk pathway, enhanced tumor growth, and decreased drug sensitivity. DUSP4/MKP2 also plays an important role in regulating the immune system where it has been implicated in regulating T and B cell proliferation and apoptosis, and adaptive and inflammatory responses. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to the following amino acid sequence: QVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYLHS. |
| Usage | |
|---|---|
| Application | IF |
| Dilutions | Immunofluorescence (0.25-2 µg/mL) |
| MW(KDa) | 42 |
| Reactivity | Human |
| Specificity | Specificity of human DUSP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.