DUSP23 Antibody - CD BioSciences

service-banner

DUSP23 Antibody

DUSP23 Antibody

SPA-03112

Size Price
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name DUSP23
Gene Abbr. DUSP23
Gene ID 54935
Full Name dual specificity phosphatase 23
Alias DUSP25, LDP-3, LDP3, MOSP, VHZ
Introduction DUSP23 is a dual substrate specificity phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. It is widely expressed and highly conserved. Most of dual-specificity protein phosphatases (DSPs) play an important role in the regulation of mitogenic signal transduction and controlling the cell cycle in response to extracellular stimuli. Reverse transcription-PCR (RT-PCR) revealed that the DUSP23 was expressed in most fetal tissues and two adult tissues: testis and colon.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: IVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK.
Usage
Application WB, IHC
Dilutions Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:50-1:200)
Reactivity Human, Mouse, Rat
Specificity Specificity of human DUSP23 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.