Online Inquiry
DUSP22 Antibody
SPA-03104
Size | Price |
0.1 mL | Online Inquiry |
25 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | DUSP22 |
Gene Abbr. | DUSP22 |
Gene ID | 56940 |
Full Name | dual specificity phosphatase 22 |
Alias | JKAP, JSP-1, JSP1, LMW-DSP2, LMWDSP2 |
Introduction | MKPX, also known as JSP-1 for Jnk Stimulatory Phosphatase-1, belongs to the LMW-DSP subfamily of phosphatases. MKPX has been shown to have the capacity to activate the c-Jun N-terminal kinase (Jnk) signaling pathway. The activation of Jnk has been implicated in a number of important physiological processes, including embryonic morphogenesis, cell survival and apoptosis. At least two mRNA transcripts have been reported. Jnk signaling has been linked to human disease conditions, such as tumor development, cardiac hypertrophy, ischemia/reperfusion injury, diabetes, hyperglycemia-induced apoptosis, and several neurodegenerative disorders.MKPX has been shown to be widely expressed with highest expression in heart, kidney, liver, lung, pancreas and placenta. |
Product Details | |
---|---|
Host | Mouse |
Clonality | Monoclonal |
Clone No. | 3D3 |
Isotype | IgG2A Kappa |
Immunogen | DUSP22 (NP_064570, 112 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL. |
Usage | |
---|---|
Application | WB, ELISA |
Dilutions | Western Blot (1:500) |
Reactivity | Human |
Validation | RNAi Validation |
Specificity | DUSP22 - dual specificity phosphatase 22. |
Storage & Handling | |
---|---|
Storage Buffer | In 1X PBS, pH 7.4. |
Preservative | No Preservative |
Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.