Online Inquiry
DUSP18 Antibody
SPA-03091
| Size | Price |
| 0.025 mg | Online Inquiry |
| 0.1 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | DUSP18 |
| Gene Abbr. | DUSP18 |
| Gene ID | 150290 |
| Full Name | dual specificity phosphatase 18 |
| Alias | DSP18, DUSP20, LMWDSP20 |
| Introduction | DUSP18 (E.C 3.1.3.16), a novel DSP, is a member of highly conserved protein-tyrosine phosphatase super family. Members of this family cooperate with protein kinases and play a vital role in cell cycle regulation and mitogenic signal transduction. DUSP18 is a low molecular weight protein consisting of conserved N-terminal DSP domain but lacks CH2 domain. Studies reveal that DUSP18 is a unique DSP that interacts and dephosphorylates SAPK/JNK. Reports suggest it inhibits SAPK/JNK in vivo and might serve an important role in the regulation of SAPK/JNK pathway. Northern Blot analysis detected a ubiquitous expression of DUSP18. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to the following amino acid sequence: APSCAFPVQFRQPSVSGLSQITKSLYISNGVAATN. |
| Usage | |
|---|---|
| Application | IF |
| Dilutions | Immunofluorescence (0.25-2 µg/mL) |
| Reactivity | Human |
| Specificity | Specificity of human DUSP18 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.