DUSP18 Antibody - CD BioSciences

service-banner

DUSP18 Antibody

DUSP18 Antibody

SPA-03091

Size Price
0.025 mg Online Inquiry
0.1 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name DUSP18
Gene Abbr. DUSP18
Gene ID 150290
Full Name dual specificity phosphatase 18
Alias DSP18, DUSP20, LMWDSP20
Introduction DUSP18 (E.C 3.1.3.16), a novel DSP, is a member of highly conserved protein-tyrosine phosphatase super family. Members of this family cooperate with protein kinases and play a vital role in cell cycle regulation and mitogenic signal transduction. DUSP18 is a low molecular weight protein consisting of conserved N-terminal DSP domain but lacks CH2 domain. Studies reveal that DUSP18 is a unique DSP that interacts and dephosphorylates SAPK/JNK. Reports suggest it inhibits SAPK/JNK in vivo and might serve an important role in the regulation of SAPK/JNK pathway. Northern Blot analysis detected a ubiquitous expression of DUSP18.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: APSCAFPVQFRQPSVSGLSQITKSLYISNGVAATN.
Usage
Application IF
Dilutions Immunofluorescence (0.25-2 µg/mL)
Reactivity Human
Specificity Specificity of human DUSP18 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.