Online Inquiry
DUSP13 Antibody
SPA-03070
| Size | Price |
| 0.025 mg | Online Inquiry |
| 0.1 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | DUSP13 |
| Gene Abbr. | DUSP13 |
| Gene ID | 51207 |
| Full Name | dual specificity phosphatase 13 |
| Alias | BEDP, DUSP13A, DUSP13B, MDSP, SKRP4 |
| Introduction | DUSP13, a novel DSP, is a member of highly conserved Protein-tyrosine phosphatase super family. Members of this family cooperate with protein kinases and play a vital role in cell cycle regulation. DUSP13 consists of a conserved catalytic domain and is expressed specifically in the testis and skeletal muscle. Based on mRNA localization and expression studies during development, DUSP13 is suggested to be expressed as 3 isoforms due to alternative splicing. Reports suggest DUSP13 might be involved in the regulation of meiosis and differentiation of testicular germ cells during spermatogenesis. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Immunogen | The immunogen for Anti-DUSP13 antibody is: synthetic peptide directed towards the N-terminal region of Human DUSP13. Peptide sequence: LNQYHLMGQTVGTENISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMT The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Reactivity | Human |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS, 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.