Online Inquiry
DPP8 Antibody
SPA-02998
Size | Price |
0.1 mL | Online Inquiry |
25 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | DPP8 |
Gene Abbr. | DPP8 |
Gene ID | 54878 |
Full Name | dipeptidyl peptidase 8 |
Alias | DP8, DPRP-1, DPRP1, MST097, MSTP097 |
Introduction | This gene encodes a member of the peptidase S9B family, a small family of dipeptidyl peptidases that are able to cleave peptide substrates at a prolyl bond. The encoded protein shares similarity with dipeptidyl peptidase IV in that it is ubiquitously expressed, and hydrolyzes the same substrates. These similarities suggest that, like dipeptidyl peptidase IV, this protein may play a role in T-cell activation and immune function. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]. |
Product Details | |
---|---|
Host | Mouse |
Clonality | Monoclonal |
Clone No. | 1B10 |
Isotype | IgG2A Kappa |
Immunogen | DPP8 (NP_932065.1, 161 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISNIVTR. |
Usage | |
---|---|
Application | ELISA |
Reactivity | Human |
Specificity | DPP8 - dipeptidyl-peptidase 8. |
Storage & Handling | |
---|---|
Storage Buffer | In 1X PBS, pH 7.4. |
Preservative | No Preservative |
Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.