Online Inquiry
DLK2/EGFL9 Antibody
SPA-02937
| Size | Price |
| 100 µL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | DLK2 |
| Gene Abbr. | DLK2 |
| Gene ID | 65989 |
| Full Name | delta like non-canonical Notch ligand 2 |
| Alias | DLK-2, EGFL9 |
| Introduction | DLK2 (protein delta homolog 2) also called Epidermal growth factor-like protein 9 (EGFL9) is a 383 aminoacid protein with a molecular weight of 40.5 kDa. DLK2 is a single-pass type I membrane protein and is a negative regulator in the Notch pathway. DLK2 regulates adipogenesis and 2 isoforms of the human protein have been described. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to the following amino acid sequence: TCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCV. |
| Usage | |
|---|---|
| Application | IF |
| Dilutions | Immunofluorescence (0.25-2 µg/mL) |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human DLK2/EGFL9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.