DFF45/ICAD Antibody - CD BioSciences

service-banner

DFF45/ICAD Antibody

DFF45/ICAD Antibody

SPA-02912

Size Price
0.1 mg Online Inquiry
0.025 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name DFF45
Gene Abbr. DFFA
Gene ID 1676
Full Name DNA fragmentation factor subunit alpha
Alias DFF-45, DFF1, ICAD
Introduction Human DFF45 and its mouse homologue ICAD function in normal cells as chaperones for caspase-activated deoxyribonuclease (DFF40 or CAD) during its synthesis. The association of DFF45 (or its isoform DFF35) with DFF40 inhibits the DNAse activity of the latter. In vitro, DFF45 has been shown to be the target of several caspases, including caspase-3, -6, -7, -8 and granzyme B. In vivo, caspase-3 is believed to be the primary enzyme responsible for processing DFF45 and release of its carboxy-terminal fragment. The cleavage of DFF45 inactivates its inhibitory function on DFF40 and causes nuclear DNA degradation by DFF40, leading to cell death.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLP.
Usage
Application IHC
Dilutions Immunohistochemistry (1:50-1:200)
MW(KDa) 45
Reactivity Human
Specificity Specificity of human DFF45/ICAD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.