Online Inquiry
DDB1 Antibody
SPA-02844
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | DDB-1 |
| Gene Abbr. | DDB1 |
| Gene ID | 1642 |
| Full Name | damage specific DNA binding protein 1 |
| Alias | DDBA, UV-DDB1, XAP1, XPCE, XPE |
| Introduction | Damaged DNA-Binding Protein (DDB) consists of a 127 kDa subunit (DDB-1) and a 48 kDa subunit (DDB-2) that contribute to the formation of the UV-damaged DNA-binding protein complex (UV-DDB). In conjunction with CUL4A and ROC-1, the UV-DDB complex forms an E3 ubiquitin ligase that recognizes a broad spectrum of DNA lesions such as cyclobutane pyrimidine dimers, 6-4 photoproducts, apurinic sites and short mismatches. The complex polyubiquitinates components of the nucleotide excision repair pathway. Loss of DDB activity has been identified in a subset of xeroderma pigmentosum complementation group E (XP-E) patients and has been linked to the deficient repair of cyclobutane pyrimidine dimers in cells derived from these patients. DDB-1 is a relatively abundant protein that is vital for normal cell function and is evolutionarily conserved in mammals, insects, worms and plants. Unlike DDB-2, lesions in DDB-1 have yet to be indentified in XP-E patients. In association with ROC-1 and CUL4A, DDB-1 functions to recruit substrate-specific targeting subunits, generally known as DCAFs or CDWs, to CUL4-RING E3 ubiquitin-protein ligase complexes. Ubiquitination of histone H2A, histone H3 and histone H4 at sites of UV-induced DNA damage by the DDB1-DDB2-CUL4A-ROC1 E3 ubiquitin-protein ligase complex may facilitate their removal from the nucleosome in order to promote DNA repair. DDB-1, in association with other CUL4-based E3 ligase complexes, has also been found to be a regulator of mTOR signaling. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: LEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGD. |
| Usage | |
|---|---|
| Application | IF, IHC |
| Dilutions | Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:200-1:500) |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human, mouse, rat DDB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.