DC-SIGNR/CD299/CLEC4M Antibody - CD BioSciences

service-banner

DC-SIGNR/CD299/CLEC4M Antibody

DC-SIGNR/CD299/CLEC4M Antibody

SPA-02836

Size Price
0.1 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name DC-SIGNR/CD299
Gene Abbr. CLEC4M
Gene ID 10332
Full Name C-type lectin domain family 4 member M
Alias CD209L, CD299, DC-SIGN2, DC-SIGNR, DCSIGNR
Introduction This gene encodes a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells. This gene is mapped to 19p13.3, in a cluster with the CD209 and CD23/FCER2 genes. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptides corresponding to CLEC4M(C-type lectin domain family 4, member M) The peptide sequence was selected from the N terminal of CLEC4M. Peptide sequence LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV. The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB, IHC
Dilutions Western Blot (1:100-1:2000); Immunohistochemistry (1:10-1:500)
Reactivity Human
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.