Online Inquiry
Daxx Antibody
SPA-02827
Size | Price |
25 µg | Online Inquiry |
100 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Daxx |
Gene Abbr. | DAXX |
Gene ID | 1616 |
Full Name | death domain associated protein |
Alias | BING2, DAP6, EAP1, SMIM40 |
Introduction | Daxx is a ubiquitously expressed protein that was originally identified through a yeast two-hybrid screen as an interactor with the cytoplasmic domain of Fas. It was found to enhance Fas-mediated apoptosis and activate the JNK pathway. However, additional studies have revealed that Daxx is actually a nuclear protein localizing to promyelocytic leukemia oncogenic domains (PODs). Nuclear interactions have since been observed with CENP-C Pax3 DNA methyltransferase I and chromatin-associated proteins, including histone deacetylase II, H2A, H2B, H3, H4 and Dek. Roles for Daxx have been suggested in transcriptional repression and cell cycle control. Loss of Daxx in mice leads to embryonic lethality with extensive developmental apoptosis, suggesting a role for Daxx directly or indirectly in suppressing cell death. Furthermore, inhibition of Daxx expression using RNAi has confirmed Daxx to be anti-apoptotic and to repress transcriptional activity of targets including NF-κB and E2F-1. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSG. |
Usage | |
---|---|
Application | IF |
Dilutions | Immunofluorescence (0.25-2 µg/mL) |
MW(KDa) | 110 |
Reactivity | Human |
Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS, pH 7.2, containing 40% glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.