Daxx Antibody - CD BioSciences

service-banner

Daxx Antibody

Daxx Antibody

SPA-02821

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name Daxx
Gene Abbr. DAXX
Gene ID 1616
Full Name death domain associated protein
Alias BING2, DAP6, EAP1, SMIM40
Introduction Daxx is a ubiquitously expressed protein that was originally identified through a yeast two-hybrid screen as an interactor with the cytoplasmic domain of Fas. It was found to enhance Fas-mediated apoptosis and activate the JNK pathway. However, additional studies have revealed that Daxx is actually a nuclear protein localizing to promyelocytic leukemia oncogenic domains (PODs). Nuclear interactions have since been observed with CENP-C Pax3 DNA methyltransferase I and chromatin-associated proteins, including histone deacetylase II, H2A, H2B, H3, H4 and Dek. Roles for Daxx have been suggested in transcriptional repression and cell cycle control. Loss of Daxx in mice leads to embryonic lethality with extensive developmental apoptosis, suggesting a role for Daxx directly or indirectly in suppressing cell death. Furthermore, inhibition of Daxx expression using RNAi has confirmed Daxx to be anti-apoptotic and to repress transcriptional activity of targets including NF-κB and E2F-1.
Product Details
Host Mouse
Clonality Monoclonal
Clone No. CL3580
Isotype IgG1
Immunogen Recombinant Protein corresponding to amino acids: ARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTR.
Usage
Application IF, IHC
Dilutions Immunofluorescence (2-10 µg/mL); Immunohistochemistry (1:200-1:500)
MW(KDa) 110
Reactivity Human
Specificity Specificity of human Daxx antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.