Online Inquiry
DAPK3/ZIPK Antibody
SPA-02792
| Size | Price |
| 0.05 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | DAPK3 |
| Gene Abbr. | DAPK3 |
| Gene ID | 1613 |
| Full Name | death associated protein kinase 3 |
| Alias | DLK, ZIP, ZIPK |
| Introduction | DAPK3, a DAPK type protein kinase, is functions in apoptotic signaling and also is believed to function in coordination of specific transcription and splicing events. DAPK3 contains a leucine zipper motif at its C terminus in addition to the N terminal kinase domain. DAPK3 binds to ATF4, a member of the activating transcription factor/cyclic AMP-responsive element-binding protein (ATF/CREB) family. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to the following amino acid sequence: DPKRRMTIAQSLEHSWIKAIRRRNVRGEDS. |
| Usage | |
|---|---|
| Application | IF |
| Dilutions | Immunofluorescence (0.25-2 µg/mL) |
| Reactivity | Human |
| Specificity | Specificity of human DAPK3/ZIPK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.