Online Inquiry
Cytochrome P450 3A5 Antibody
SPA-02736
| Size | Price |
| 0.025 mL | Online Inquiry |
| 0.1 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Cytochrome P450 |
| Gene Abbr. | CYP3A5 |
| Gene ID | 1577 |
| Full Name | cytochrome P450 family 3 subfamily A member 5 |
| Alias | CP35, CYPIIIA5, P450PCN3, PCN3 |
| Introduction | This gene,CYP3A5, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. The enzyme metabolizes drugs such as nifedipine and cyclosporine as well as the steroid hormones testosterone, progesterone and androstenedione. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. This cluster includes a pseudogene, CYP3A5P1, which is very similar to CYP3A5. This similarity has caused some difficulty in determining whether cloned sequences represent the gene or the pseudogene. Multiple alternatively spliced transcript variants have been identified for this gene. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to CYP3A5 (cytochrome P450, family 3, subfamily A, polypeptide 5) The peptide sequence was selected from the N terminal of CYP3A5. Peptide sequence AITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSL. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (1:100-1:2000) |
| Reactivity | Human, Porcine, Canine, Guinea Pig |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.