Online Inquiry
CYP7B1 Antibody
SPA-02752
| Size | Price |
| 0.1 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Cytochrome P450 |
| Gene Abbr. | CYP7B1 |
| Gene ID | 9420 |
| Full Name | cytochrome P450 family 7 subfamily B member 1 |
| Alias | CBAS3, CP7B, SPG5A |
| Introduction | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway of extrahepatic tissues, which converts cholesterol to bile acids. This enzyme likely plays a minor role in total bile acid synthesis, but may also be involved in the development of atherosclerosis, neurosteroid metabolism and sex hormone synthesis. [provided by RefSeq] |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | 2B11 |
| Isotype | IgG2A Kappa |
| Immunogen | CYP7B1 (NP_004811, 203 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHH. |
| Usage | |
|---|---|
| Application | WB, ELISA, IHC |
| Dilutions | Western Blot (1:500) |
| Reactivity | Human |
| Specificity | CYP7B1 - cytochrome P450, family 7, subfamily B, polypeptide 1. |
| Storage & Handling | |
|---|---|
| Storage Buffer | In 1X PBS, pH 7.4. |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.