CYP3A7 Antibody - CD BioSciences

service-banner

CYP3A7 Antibody

CYP3A7 Antibody

SPA-02742

Size Price
100 µL Online Inquiry
20 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name Cytochrome P450
Gene Abbr. CYP3A7
Gene ID 1551
Full Name cytochrome P450 family 3 subfamily A member 7
Alias CP37, CYPIIIA7, P-450(HFL33), P-450111A7, P450-HFLA
Introduction This gene, CYP3A7, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Transcript variants have been described, but it is not known whether these transcripts are normally produced. [provided by RefSeq]
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptides corresponding to CYP3A7(cytochrome P450, family 3, subfamily A, polypeptide 7) The peptide sequence was selected from the middle region of CYP3A7. Peptide sequence KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSG. The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Dilutions Western Blot (1:100-1:2000)
Reactivity Human
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.