CYP3A43 Antibody - CD BioSciences

service-banner

CYP3A43 Antibody

CYP3A43 Antibody

SPA-02731

Size Price
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name Cytochrome P450
Gene Abbr. CYP3A43
Gene ID 64816
Full Name cytochrome P450 family 3 subfamily A member 43
Introduction This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Alternate splicing of this gene results in three transcript variants encoding different isoforms. [provided by RefSeq]
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptides corresponding to CYP3A43(cytochrome P450, family 3, subfamily A, polypeptide 43) The peptide sequence was selected from the middle region of CYP3A43. Peptide sequence ERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIII. The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB, IHC
Dilutions Western Blot (1:100-1:2000)
Reactivity Human
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.