Online Inquiry
CYP3A43 Antibody
SPA-02730
| Size | Price |
| 0.1 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Cytochrome P450 |
| Gene Abbr. | CYP3A43 |
| Gene ID | 64816 |
| Full Name | cytochrome P450 family 3 subfamily A member 43 |
| Introduction | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Alternate splicing of this gene results in three transcript variants encoding different isoforms. [provided by RefSeq] |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to CYP3A43(cytochrome P450, family 3, subfamily A, polypeptide 43) The peptide sequence was selected from the C terminal of CYP3A43. Peptide sequence IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (1:100-1:2000) |
| Reactivity | Human, Rat, Porcine, Bovine, Equine, Sheep |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.