Online Inquiry
CXCR7/RDC-1 Antibody
SPA-02594
Size | Price |
0.025 mg | Online Inquiry |
0.1 mg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | CXCR7/RDC-1 |
Gene Abbr. | ACKR3 |
Gene ID | 57007 |
Full Name | atypical chemokine receptor 3 |
Alias | CMKOR1, CXC-R7, CXCR-7, CXCR7, GPR159 |
Introduction | CXCR7 (CXC chemokine receptor 7; also GPRN1, RDC1 and chemokine orphan receptor 1) is a 60 kDa member of the G-protein coupled receptor 1 family. It is expressed on multiple cell types, including neurons, T cells, NK cells, neutrophils, B cells plus angiogenic endothelial cells. CXCR7 forms both homodimers and heterodimers with CXCR4. It selectively binds I-TAC and SDF1, and appears to involve beta -arrestin2 during signaling. Notably, a CXCR7:CXCR4 heterodimer shows increased responsiveness to SDF1, and I-TAC may actually block some SDF1-mediated migration activity. Mouse CXCR7 is a 7-transmembrane glycoprotein that is 362 amino acids (aa) in length. It contains a 47 aa N-terminal extracellular region plus a 43 aa C-terminal cytoplasmic domain. Over aa 1‑47, 103‑118, 184‑213 and 274‑296 collectively, mouse CXCR7 shares 97% and 91% aa identity with rat and human CXCR7, respectively. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY. |
Usage | |
---|---|
Application | IHC |
Dilutions | Immunohistochemistry (1:20-1:50) |
Reactivity | Human |
Specificity | Specificity of human CXCR7/RDC-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.