CXCR7/RDC-1 Antibody - CD BioSciences

service-banner

CXCR7/RDC-1 Antibody

CXCR7/RDC-1 Antibody

SPA-02592

Size Price
0.025 mg Online Inquiry
0.1 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name CXCR7/RDC-1
Gene Abbr. ACKR3
Gene ID 57007
Full Name atypical chemokine receptor 3
Alias CMKOR1, CXC-R7, CXCR-7, CXCR7, GPR159
Introduction CXCR7 (CXC chemokine receptor 7; also GPRN1, RDC1 and chemokine orphan receptor 1) is a 60 kDa member of the G-protein coupled receptor 1 family. It is expressed on multiple cell types, including neurons, T cells, NK cells, neutrophils, B cells plus angiogenic endothelial cells. CXCR7 forms both homodimers and heterodimers with CXCR4. It selectively binds I-TAC and SDF1, and appears to involve beta -arrestin2 during signaling. Notably, a CXCR7:CXCR4 heterodimer shows increased responsiveness to SDF1, and I-TAC may actually block some SDF1-mediated migration activity. Mouse CXCR7 is a 7-transmembrane glycoprotein that is 362 amino acids (aa) in length. It contains a 47 aa N-terminal extracellular region plus a 43 aa C-terminal cytoplasmic domain. Over aa 1‑47, 103‑118, 184‑213 and 274‑296 collectively, mouse CXCR7 shares 97% and 91% aa identity with rat and human CXCR7, respectively.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY.
Usage
Application WB, IF
Dilutions Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL)
Reactivity Human
Specificity Specificity of human CXCR7/RDC-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.