Online Inquiry
CXCR1/IL-8RA Antibody
SPA-02546
Size | Price |
0.1 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | CXCR1/IL-8RA |
Gene Abbr. | CXCR1 |
Gene ID | 3577 |
Full Name | C-X-C motif chemokine receptor 1 |
Alias | C-C, C-C-CKR-1, CD128, CD181, CDw128a |
Introduction | The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. Knockout studies in mice suggested that this protein inhibits embryonic oligodendrocyte precursor migration in developing spinal cord. This gene, IL8RB, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36. [provided by RefSeq] |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK. |
Usage | |
---|---|
Application | IHC |
Dilutions | Immunohistochemistry (1:500-1:1000) |
Reactivity | Human |
Specificity | Specificity of human CXCR1/IL-8 RA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.