CXCR1/IL-8RA Antibody - CD BioSciences

service-banner

CXCR1/IL-8RA Antibody

CXCR1/IL-8RA Antibody

SPA-02546

Size Price
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name CXCR1/IL-8RA
Gene Abbr. CXCR1
Gene ID 3577
Full Name C-X-C motif chemokine receptor 1
Alias C-C, C-C-CKR-1, CD128, CD181, CDw128a
Introduction The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. Knockout studies in mice suggested that this protein inhibits embryonic oligodendrocyte precursor migration in developing spinal cord. This gene, IL8RB, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36. [provided by RefSeq]
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK.
Usage
Application IHC
Dilutions Immunohistochemistry (1:500-1:1000)
Reactivity Human
Specificity Specificity of human CXCR1/IL-8 RA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.