Online Inquiry
CX3CL1/Fractalkine Antibody
SPA-04125
Size | Price |
0.025 mL | Online Inquiry |
0.1 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Fractalkine |
Gene Abbr. | CX3CL1 |
Gene ID | 6376 |
Full Name | C-X3-C motif chemokine ligand 1 |
Alias | ABCD-3, C3Xkine, CXC3, CXC3C, NTN |
Introduction | CX3CL1, also known as Fractalkine, is a type I membrane protein in which a chemokine domain possessing a unique C-X3-C cysteine motif is tethered on a long mucin-like stalk. It can also be released as a soluble molecule upon proteolysis at a membrane proximal site. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: GVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLE. |
Usage | |
---|---|
Application | IHC |
Dilutions | Immunohistochemistry (1:500-1:1000) |
Reactivity | Human |
Specificity | Specificity of human CX3CL1/Fractalkine antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.