Online Inquiry
Crossveinless-2/CV-2/BMPER Antibody
SPA-01108
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | BMPER |
| Gene Abbr. | BMPER |
| Gene ID | 168667 |
| Full Name | BMP binding endothelial regulator |
| Alias | CRIM3, CV-2, CV2 |
| Introduction | BMPER contains 1 TIL (trypsin inhibitory-like) domain, 5 VWFC domains and 1 VWFD domain.BMPER is the inhibitor of bone morphogenetic protein (BMP) functions. It may regulate BMP responsiveness of osteoblasts and chondrocytes. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to BMPER(BMP binding endothelial regulator) The peptide sequence was selected from the C terminal of BMPER. Peptide sequence NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (1:100-1:2000); Immunohistochemistry (1:10-1:500) |
| Reactivity | Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.