Online Inquiry
CRHR2/CRF2 Antibody
SPA-02366
| Size | Price |
| 0.025 mg | Online Inquiry |
| 0.1 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | CRHR2/CRF2 |
| Gene Abbr. | CRHR2 |
| Gene ID | 1395 |
| Full Name | corticotropin releasing hormone receptor 2 |
| Alias | CRF-RB, CRF2, CRFR2, HM-CRF |
| Introduction | CRHR2 is a novel member of Secretin-family-GPCR proteins that functions as a functional receptor for CRF. It is expressed as 3 isoforms; alpha, beta and gamma. These isoforms primarily differ in their N-terminal sequence and tissue distribution. Apart from CRF, other ligands of CRHR2 include UcnI, UcnII and UcnIII. CRHR2 is involved in stress responses, cardiovascular function and gastric motility. Studies on CRHR2 deficient mice suggested a central anxiolytic effect of CRHR2. Northern Blot analysis detects CRHR2 expression in brain, hypothalamus, heart, GI, lung, skeletal muscle and vasculature. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Immunogen | Synthetic peptide directed towards the N-terminal region of CRHR2/CRF2. Peptide sequence: NTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWA The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Reactivity | Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS, 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.