Online Inquiry
CPXM2 Antibody
SPA-01340
| Size | Price |
| 0.1 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Carboxypeptidase |
| Gene Abbr. | CPXM2 |
| Gene ID | 119587 |
| Full Name | carboxypeptidase X, M14 family member 2 |
| Alias | CPX2, UNQ676 |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | 3E4 |
| Isotype | IgG2B Kappa |
| Immunogen | CPXM2 (NP_937791, 190 a.a. ~ 279 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLQQWIEVDARRLTRFTGVITQGRNSLWLSDWVTSYKVMVSNDSHTWVTVKNGSGDMIFEGNSEKEIPVLNELPVPMVARYIRINPQSWF. |
| Usage | |
|---|---|
| Application | ELISA |
| Reactivity | Human |
| Specificity | CPXM2. |
| Storage & Handling | |
|---|---|
| Storage Buffer | In 1X PBS, pH 7.4. |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.