Online Inquiry
COX-1 Antibody
SPA-02311
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | COX-1 |
| Gene Abbr. | PTGS1 |
| Gene ID | 5742 |
| Full Name | prostaglandin-endoperoxide synthase 1 |
| Alias | COX1, COX3, PCOX1, PES-1, PGG/HS |
| Introduction | Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes PTGS1, which regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. PTGS1 is thought to be involved in cell-cell signaling and maintaining tissue homeostasis. Alternative splicing of this gene generates two transcript variants. The expression of these two transcripts is differentially regulated by relevant cytokines and growth factors. [provided by RefSeq] |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to PTGS1(prostaglandin-endoperoxide synthase 1) The peptide sequence was selected form the middle region of PTGS1. Peptide sequence GFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEE. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Immunohistochemistry (1:10-1:500) |
| Reactivity | Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.