Corticotropin Releasing Factor Antibody - CD BioSciences

service-banner

Corticotropin Releasing Factor Antibody

Corticotropin Releasing Factor Antibody

SPA-02300

Size Price
0.1 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name Corticotropin Releasing Factor
Gene Abbr. CRH
Gene ID 1392
Full Name corticotropin releasing hormone
Alias CRF, CRH1
Introduction Corticotropin-releasing hormone (CRH) is a 41-amino acid peptide derived from a 191-amino acid preprohormone. CRH is secreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. Marked reduction in CRH has been observed in association with Alzheimer disease and autosomal recessive hypothalamic corticotropin dificiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, CRH is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed in the placenta. In the placenta CRH is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of CRH occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, CRH may act as a trigger for parturition.
Product Details
Host Mouse
Clonality Monoclonal
Clone No. 2B11
Isotype IgG2A Kappa
Immunogen CRH (AAH11031, 154 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK.
Usage
Application WB, ELISA, IHC
Dilutions Western Blot (1:500)
Reactivity Human
Specificity CRH.
Storage & Handling
Storage Buffer In 1X PBS, pH 7.4.
Preservative No Preservative
Storage Temp. Aliquot and store at -20 °C or -80 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.