Common gamma Chain/IL-2 R gamma Antibody - CD BioSciences

service-banner

Common gamma Chain/IL-2 R gamma Antibody

Common gamma Chain/IL-2 R gamma Antibody

SPA-05756

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name IL-2 Receptor
Gene Abbr. IL2RG
Gene ID 3561
Full Name interleukin 2 receptor subunit gamma
Alias CD132, CIDX, IL-2RG, IMD4, P64
Introduction The Common gamma Chain, also known as CD132, is a transmembrane protein belonging to the hematopoietin receptor family. gamma c is a signaling component of the functional receptor complexes for IL-2, IL-4, IL-7, IL-9, and IL-15.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: TFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFAL.
Usage
Application IF
Dilutions Immunofluorescence (0.25-2 µg/mL)
Reactivity Human
Specificity Specificity of human Common gamma Chain/IL-2 R gamma antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.