Online Inquiry
Common beta Chain/beta-c Antibody
SPA-01035
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | beta-c |
| Gene Abbr. | CSF2RB |
| Gene ID | 1439 |
| Full Name | colony stimulating factor 2 receptor subunit beta |
| Alias | CD131, CDw131, IL3RB, IL5RB, SMDP5 |
| Introduction | The common beta-chain (beta-c) of the granulocyte macrophage colony-stimulating factor (GM-CSF), interleukin-3 (IL-3) and IL-5 receptors is the major signaling subunit of these receptors, coupling ligand binding to multiple biological activities. Tyrosine phosphorylation of cytokine receptor common beta-chain is one of the first events in GM-CSF, IL-3 and IL-5 receptor activation and in signaling initiation. Serine phosphorylation within the 14-3-3 binding sequence of the common beta-chain is also involved in GM-CSF, IL-3 and IL-5 receptor-specific functions. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: QQVGDYCFLPGLGPGPLSLRSKPSSPGPGPEIKNLDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLP. |
| Usage | |
|---|---|
| Application | IF |
| Dilutions | Immunofluorescence (0.25-2 µg/mL) |
| Reactivity | Human |
| Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS, pH 7.2, containing 40% glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.