Online Inquiry
CNP/NPPC Antibody
SPA-02275
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | CNP/NPPC |
| Gene Abbr. | NPPC |
| Gene ID | 4880 |
| Full Name | natriuretic peptide C |
| Alias | CNP, CNP2 |
| Introduction | C-Type Natriuretic Peptide (CNP) belongs to the natriuretic peptide family and functions in an autocrine or paracrine fashion. CNP interacts with the GC-B/NPR-B receptor to promote vasorelaxation, vascular remodeling, and the growth and differentiation of bone and neural tissue. CNP is synthesized as a prohormone that is cleaved intracellularly by furin, yielding a 49 aa propeptide and a 53 aa mature peptide (CNP53). Additional cleavage of the mature peptide generates 29 aa and 22 aa peptides (CNP29 and CNP22) which have comparable activity in some assays. Within the 53 aa mature CNP, human shares 96% aa sequence identity with mouse and rat. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: PKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:50-1:200) |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human CNP/NPPC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.