Cip4 Antibody - CD BioSciences

service-banner

Cip4 Antibody

Cip4 Antibody

SPA-02253

Size Price
100 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name Cip4
Gene Abbr. TRIP10
Gene ID 9322
Full Name thyroid hormone receptor interactor 10
Alias CIP4, HSTP, STOT, STP, TRIP-10
Introduction TRIP10/CIP4 is a multi-functional adapter protein and plays a role in the translocation of Glut4 (glucose transporter) vesicles to the cell surface in response to insulin. TRIP10/CIP4 has also been found to interact with the active GTPases CDC42 and TC10 as well as the Wiskott-Aldrich syndrome protein (WASP), a protein involved in cytoskeletal organization. Recent studies suggest that CIP4 accumulation may play a role in Huntington's disease pathogenesis.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: LQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELEVVPIIA.
Usage
Application IHC
Dilutions Immunohistochemistry (1:500-1:1000)
Reactivity Human, Mouse
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.