Online Inquiry
Chordin Antibody
SPA-02216
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Chordin |
| Gene Abbr. | CHRD |
| Gene ID | 8646 |
| Full Name | chordin |
| Introduction | Chordin is a secreted glycoprotein that regulates dorsoventral patterning during gastrulation. Chordin functions as a bone morphogenetic protein (BMP) antagonist that blocks their ventralizing activity by binding to the BMPs and inhibiting their interaction with their receptors. Mouse Chordin cDNA encodes a 948 amino acid (aa) residue precursor protein with a putative 26 aa residue signal peptide. Chordin contains four internal cysteine-rich repeats (CRs) that are conserved in the spacing of their ten cysteine residues. The CRs of chordin, especially CR1 and CR3, have been shown to be the functional domains for BMP binding. These conserved CRs are present in an expanding family of secreted molecules that antagonize BMP signaling. Xolloid (an extracellular zinc metalloproteinase) can cleave chordin at two specific sites resulting in chordin fragments with lower BMP-affinity. Cleavage of the chordin/BMP complex can reverse the BMP antagonist activity of chordin. Mouse chordin is expressed at high levels in 7 day postcoitum mouse embryos. Chordin expression is also detected in multiple fetal and adult tissues, most notably liver and cerebellum, suggesting additional roles for chordin in organogenesis and homeostasis. De Robertis, E.M. and Y. Sasai (1996) Nature 380:37. Larrain, J. et al. (2000) Development 127:821. Coffinier, C. et al. (2001) Mech. Dev. 100:119. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: PNTCFFEGQQRPHGARWAPNYDPLCSLCTCQRRTVICDPVVCPPPSCPHPVQAPDQCCPVCPEKQDVRDLPGLPRSRDPGEGCYFDGDRSW. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:20-1:50) |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human Chordin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.