CHES1 Antibody - CD BioSciences

service-banner

CHES1 Antibody

CHES1 Antibody

SPA-02171

Size Price
0.1 mL Online Inquiry
25 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name CHES1
Gene Abbr. FOXN3
Gene ID 1112
Full Name forkhead box N3
Alias C14orf116, CHES1, PRO1635
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the middle region of human CHES1. Peptide sequence: HKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLLHLAGIR The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Reactivity Human, Mouse, Rat, Canine, Equine, Guinea Pig
Storage & Handling
Storage Buffer PBS, 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.